Antibodies

View as table Download

Rabbit Polyclonal antibody to COUP TF1 (nuclear receptor subfamily 2, group F, member 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 44 of COUP TF1 (Uniprot ID#P10589)

Rabbit polyclonal NR2F1 Antibody (N-term)

Applications WB
Reactivities Human (Predicted: Bovine)
Conjugation Unconjugated
Immunogen This NR2F1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 48-76 amino acids from the N-terminal region of human NR2F1.

Rabbit Polyclonal Anti-NR2F1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the N terminal of human NR2F1. Synthetic peptide located within the following region: GEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECV

Rabbit Polyclonal Anti-NR2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the N terminal of human NR2F1. Synthetic peptide located within the following region: GEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECV

Rabbit Polyclonal Anti-NR2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the C terminal of human NR2F1. Synthetic peptide located within the following region: VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP

NR2F1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F1