Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-CACNG7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG7. |
Antibodies
View as table Download
Anti-GJC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 420-434 amino acids of Human gap junction protein, gamma 2, 47kDa |
Rabbit Polyclonal Anti-KCNE3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RSRKVDKRSDPYH, corresponding to amino acid residues 81-93 of human KCNE3 (Accession Q9Y6H6 ). Intracellular, C-terminal part. |
Rabbit polyclonal Anti-ASIC2a
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide DLKESPSEGSLQPSSIQC, corresponding to amino acid residues 2-18 of human ASIC2a. Intracellular, N-terminus. |
Rabbit Polyclonal Anti-Cacnb2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Cacnb2 antibody is: synthetic peptide directed towards the middle region of Rat Cacnb2. Synthetic peptide located within the following region: DFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQ |
Rabbit Polyclonal Anti-Connexin 26 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 26 Antibody: A synthesized peptide derived from the extracellular region of human Connexin 26 |
Rabbit Polyclonal Anti-Connexin 32 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 32 Antibody: A synthesized peptide derived from human Connexin 32 |
Rabbit Polyclonal Anti-AQP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AQP1 Antibody: A synthesized peptide derived from human AQP1 |
Rabbit Polyclonal Anti-Connexin 43 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 43 Antibody: A synthesized peptide derived from human Connexin 43 |
Rabbit Polyclonal Anti-TNFAIP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TNFAIP1 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human TNFAIP1. |
Rabbit anti Connexin 43 (pS368) Polyclonal Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminal region with a phosphorylated Serine368 of human Connexin 43. |
Rabbit polyclonal Connexin 43 (Ser265) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Connexin 43 around the phosphorylation site of Serine 265. |
| Modifications | Phospho-specific |
Rabbit anti Connexin 43 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a segment of the 3rd cytoplasmic domain of human/rat connexin 43 protein. |
Active filters
Reactivities
- Rat
Antibody Hosts
- Rabbit
Families
- Ion Channels: Other
Filter by
Category
Target Symbol
- GJA1 (13)
- AQUAPORIN 1 (6)
- TNFAIP1 (5)
- CLCN4 (3)
- CLIC4 (3)
- GJB2 (3)
- GJC1 (3)
- KCNMB2 (3)
- VDAC1 (3)
- CACNB2 (2)
- CACNG1 (2)
- CLCN1 (2)
- CLIC1 (2)
- CYBB (2)
- GJA4 (2)
- GJB1 (2)
- GJC2 (2)
- KCNH6 (2)
- VDAC2 (2)
- ACCN1 (1)
- ACCN2 (1)
- BEST4 (1)
- CACNA2D3 (1)
- CACNA2D4 (1)
- CACNB1 (1)
- CACNG7 (1)
- CHLORIDE CHANNEL 5 (1)
- CHRFAM7A (1)
- CLC7 (1)
- CLCA4 (1)
- CLIC3 (1)
- FXYD1 (1)
- GJA3 (1)
- GJA8 (1)
- GJB5 (1)
- GJD2 (1)
- KCNE3 (1)
- KCNG3 (1)
- KCNMB1 (1)
- KCNMB4 (1)
- KCTD15 (1)
- MLC1 (1)
- MRP4 (1)
- NOX1 (1)
- VDAC3 (1)
Applications
Isotypes
Clonalities
Conjugates
Modifications
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (21)
- Gap junction (14)
- Cardiac muscle contraction (8)
- Dilated cardiomyopathy (8)
- Hypertrophic cardiomyopathy (HCM) (8)
- MAPK signaling pathway (8)
- Calcium signaling pathway (6)
- Huntington's disease (6)
- Parkinson's disease (6)
- Vascular smooth muscle contraction (5)
- Leukocyte transendothelial migration (3)
- ABC transporters (1)
- Olfactory transduction (1)
- Taste transduction (1)