Antibodies

Jump to Filters
View as table Download
Frizzled 10 (FZD10) Rabbit Polyclonal Antibody
TA322436

USD 380.00

In Stock

Anti-FZD10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 171-185 amino acids of human frizzled family receptor 10
Frizzled 10 (FZD10) Rabbit Polyclonal Antibody
TA315158

USD 380.00

In Stock

Rabbit polyclonal anti-FZD10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD10.
Frizzled 10 (FZD10) Rabbit Polyclonal Antibody
TA344071

USD 539.00

5 Days

Rabbit Polyclonal Anti-FZD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the N terminal of human FZD10. Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF