Rabbit Polyclonal Anti-PAX4 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the middle region of human PAX4. Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA |
PAX4 (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the ?-terminal region of human PAX4 Antibody (Center). |
Rabbit Polyclonal Anti-PAX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the N terminal of human PAX4. Synthetic peptide located within the following region: ISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLK |
Germany
Japan
United Kingdom
China
