Antibodies

Jump to Filters
View as table Download
alpha Actinin (ACTN1) Rabbit Polyclonal Antibody
TA321277

USD 380.00

In Stock

Anti-ACTN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 2470 amino acids of human actinin, alpha 1
alpha Actinin (ACTN1) Rabbit Polyclonal Antibody
TA344352

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ
CD32A (FCGR2A) Rabbit Polyclonal Antibody
TA327039

USD 365.00

In Stock

FCGR2A Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FCGR2A
alpha Actinin (ACTN1) Rabbit Polyclonal Antibody
TA311843

USD 380.00

In Stock

Rabbit polyclonal anti-ACTN1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN1.