Antibodies

View as table Download

Rabbit Polyclonal Antibody against YAP

Applications ChIP, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant YAP protein expressed in bacteria.

Rabbit Polyclonal Anti-YAP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-YAP1 antibody: synthetic peptide directed towards the C terminal of human YAP1. Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS

Rabbit polyclonal anti-YAP antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human YAP.

Rabbit Polyclonal YAP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human YAP

Rabbit Polyclonal YAP (Ser127) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human YAP around the phosphorylation site of Serine 127
Modifications Phospho-specific

YAP1 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human YAP1

YAP1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 103-133 amino acids from the Central region of human YAP