Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit polyclonal anti-MAPK9 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK9. |
Rabbit polyclonal Anti-MAPK6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPK6 antibody: synthetic peptide directed towards the middle region of human MAPK6. Synthetic peptide located within the following region: QVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSHTC |
Rabbit Polyclonal Anti-p97 MAPK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p97 MAPK Antibody: A synthesized peptide derived from human p97 MAPK |
Active filters
Target Symbol
- MAPK6
Antibody Hosts
- Rabbit
Families
- Druggable Genome