Antibodies

Jump to Filters
View as table Download
PDE4 (PDE4B) (Center) Rabbit Polyclonal Antibody
AP53236PU-N

USD 580.00

2 Weeks

PDE4 (PDE4B) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 196-225 amino acids from the Central region of Human PDE4B
PDE4 (PDE4B) Rabbit Polyclonal Antibody
TA308931

USD 625.00

5 Days

Rabbit polyclonal antibody to Phosphodiesterase 4B (phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila))

Applications WB
Reactivities Human (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 489 and 736 of PDE4B (Uniprot ID#Q07343)
PDE4 (PDE4B) Rabbit Polyclonal Antibody
TA336008

USD 539.00

5 Days

Rabbit Polyclonal Anti-PDE4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE4B Antibody: synthetic peptide directed towards the middle region of human PDE4B. Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED