Antibodies

View as table Download

Rabbit Polyclonal Anti-RDH11 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RDH11

Rabbit Polyclonal Anti-RDH11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RDH11 antibody: synthetic peptide directed towards the C terminal of human RDH11. Synthetic peptide located within the following region: SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR