Antibodies

View as table Download

Rabbit Polyclonal 5-Lipoxygenase Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within residues 100-200 of human 5-Lipoxygenase. [Swiss-Prot# P09917]

Rabbit Polyclonal 5-Lipoxygenase Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Rabbit
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region within residues 600-674 of human 5-Lipoxygenase. [Swiss-Prot# P09917]

Anti-ALOX5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 359 amino acids of Human Arachidonate 5-lipoxygenase Arachidonate 5-lipoxygenase

Anti-ALOX5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 359 amino acids of Human Arachidonate 5-lipoxygenase Arachidonate 5-lipoxygenase

Rabbit Anti-5-Lipoxygenase (Ser523) Antibody (Phospho-Specific)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser523 conjugated to KLH
Modifications Phospho-specific

Rabbit Polyclonal Anti-ALOX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human ALOX5. Synthetic peptide located within the following region: FGQLFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYY

Rabbit Polyclonal Anti-Phospho-ALOX5(Ser523) Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-ALOX5(Ser523) Antibody: A synthesized peptide derived from human ALOX5 around the phosphorylation site of Sersine 523
Modifications Phospho-specific

Rabbit polyclonal ALOX5 (Phospho-Ser523) antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ALOX5 around the phosphorylation site of serine523.
Modifications Phospho-specific