Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-SRF rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 495-508 amino acids of human serum response factor (c-fos serum response element-binding transcription factor) |
Rabbit Polyclonal Anti-SRF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRF antibody: synthetic peptide directed towards the N terminal of human SRF. Synthetic peptide located within the following region: ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIM |
Rabbit Polyclonal SRF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SRF |
Rabbit Polyclonal SRF (Ser99) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SRF around the phosphorylation site of Serine 99 |
| Modifications | Phospho-specific |
Rabbit polyclonal SRF (Ser77) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SRF around the phosphorylation site of serine 77 (L-Y-SP-G-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SRF Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRF Antibody: A synthesized peptide derived from human SRF |
Active filters
Target Symbol
- SERUM RESPONSE FACTOR
Reactivities
- Human
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Pathways
- MAPK signaling pathway