Rabbit Polyclonal Anti-PIGK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIGK antibody: synthetic peptide directed towards the N terminal of human PIGK. Synthetic peptide located within the following region: SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD |
Rabbit Polyclonal Anti-GPLD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPLD1 antibody is: synthetic peptide directed towards the N-terminal region of Human GPLD1. Synthetic peptide located within the following region: GKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMA |
Rabbit Polyclonal Anti-PIGK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIGK antibody: synthetic peptide directed towards the N terminal of human PIGK. Synthetic peptide located within the following region: MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLV |
PIGK Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PIGK |
Germany
Japan
United Kingdom
China