Antibodies

View as table Download

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit anti-ADH5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADH5

Anti-ACADS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA dehydrogenase, C-2 to C-3 short chain

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).

Rabbit Polyclonal Anti-ACADVL Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADVL antibody: synthetic peptide directed towards the N terminal of human ACADVL. Synthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV

Anti-ACADS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA dehydrogenase, C-2 to C-3 short chain

Anti-ALDH9A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1

Anti-ALDH9A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1

Rabbit Polyclonal Anti-ACSL4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACSL4

Anti-ADH1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human alcohol dehydrogenase 1A (class I), alpha polypeptide

Rabbit polyclonal ADH7 Antibody (C-Term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ADH7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-346 amino acids from the C-terminal region of human ADH7.

ACADM rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 196~225 amino acids from the Center region of Human ACADM.

Rabbit polyclonal ADH1B Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Chicken)
Conjugation Unconjugated
Immunogen This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B.

Anti-ADH4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human alcohol dehydrogenase 4 (class II), pi polypeptide

Anti-CPT1A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human carnitine palmitoyltransferase 1A (liver)