Antibodies

View as table Download

Rabbit Polyclonal Anti-E2F3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen E2F3 antibody was raised against a 15 amino acid peptide near the center of human E2F3.

E2F3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human E2F3

Rabbit Polyclonal Anti-E2F3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F3 antibody: synthetic peptide directed towards the C terminal of human E2F3. Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK