USD 380.00
In Stock
Rabbit polyclonal anti-KAP0 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human KAP0. |
USD 380.00
In Stock
Rabbit polyclonal anti-KAP0 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human KAP0. |
USD 539.00
5 Days
Rabbit Polyclonal Anti-PRKAR1A Antibody - N-terminal region
Applications | WB |
Reactivities | Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Prkar1a antibody is: synthetic peptide directed towards the N-terminal region of Rat Prkar1a. Synthetic peptide located within the following region: REYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAI |