Antibodies

Jump to Filters
View as table Download
UBE3B Rabbit Polyclonal Antibody
TA315966

USD 380.00

4 Weeks

Rabbit polyclonal anti-UBE3B antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human UBE3B.
UBE3B Rabbit Polyclonal Antibody
TA330496

USD 539.00

5 Days

Rabbit Polyclonal Anti-UBE3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE3B antibody: synthetic peptide directed towards the middle region of human UBE3B. Synthetic peptide located within the following region: VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE