Antibodies

Jump to Filters
View as table Download
GTP cyclohydrolase 1 (GCH1) Rabbit Polyclonal Antibody
TA321072

USD 380.00

In Stock

Anti-GCH1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-64 amino acids of human GTP cyclohydrolase 1
GTP cyclohydrolase 1 (GCH1) Rabbit Polyclonal Antibody
TA342673

USD 539.00

5 Days

Rabbit Polyclonal Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GCH1 antibody: synthetic peptide directed towards the C terminal of human GCH1. Synthetic peptide located within the following region: LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLT
GTP cyclohydrolase 1 (GCH1) Rabbit Polyclonal Antibody
TA342674

USD 539.00

5 Days

Rabbit Polyclonal Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GCH1 antibody is: synthetic peptide directed towards the N-terminal region of Human GCH1. Synthetic peptide located within the following region: PPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQR