Antibodies

Jump to Filters
View as table Download
SDF1 (CXCL12) Rabbit Polyclonal Antibody
TA323612

USD 380.00

4 Weeks

Anti-CXCL12 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12
SDF1 (CXCL12) Rabbit Polyclonal Antibody
TA323613

USD 380.00

4 Weeks

Anti-CXCL12 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12
SDF1 (CXCL12) Rabbit Polyclonal Antibody
TA347900

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-SDF 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1
SDF1 (CXCL12) Rabbit Polyclonal Antibody
TA330383

USD 539.00

5 Days

Rabbit Polyclonal Anti-CXCL12 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL12 antibody: synthetic peptide directed towards the middle region of human CXCL12. Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM