Antibodies

View as table Download

Rabbit Polyclonal Anti-P2RXL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RXL1 antibody: synthetic peptide directed towards the N terminal of human P2RXL1. Synthetic peptide located within the following region: NWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLEPQFSIITKLKGVSV

Rabbit Polyclonal Anti-P2RXL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RXL1 antibody: synthetic peptide directed towards the N terminal of human P2RXL1. Synthetic peptide located within the following region: ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTN