Antibodies

View as table Download

Rabbit Polyclonal Anti-SFRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRP1 antibody: synthetic peptide directed towards the middle region of human SFRP1. Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT

Rabbit Polyclonal Anti-WNT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT6 antibody: synthetic peptide directed towards the middle region of human WNT6. Synthetic peptide located within the following region: ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG