Rabbit Polyclonal Aurora A Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an N-terminal region of the human Aurora A protein (within residues 50-200). [Swiss-Prot O14965] |
Rabbit Polyclonal anti-AURKA antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AURKA antibody: synthetic peptide directed towards the C terminal of human AURKA. Synthetic peptide located within the following region: ARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS |
Rabbit Polyclonal Aurora Kinase Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Aurora Kinase |
Rabbit Polyclonal Aurora Kinase (Thr288) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Aurora Kinase around the phosphorylation site of Threonine 288 |
| Modifications | Phospho-specific |
AURKA Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AURKA |
Rabbit Polyclonal Anti-AURKA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AURKA Antibody is: synthetic peptide directed towards the middle region of Human AURKA. Synthetic peptide located within the following region: REKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYF |
Rabbit Polyclonal Anti-AurA Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AurA Antibody: A synthesized peptide derived from human AurA |
Germany
Japan
United Kingdom
China
