Antibodies

Jump to Filters
View as table Download
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA321403

USD 380.00

In Stock

Anti-CKM Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 14-26 amino acids of Human creatine kinase, muscle
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA313625

USD 380.00

In Stock

Rabbit polyclonal anti-CKM / M-CK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human M-CK.
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
AP06658PU-N

USD 465.00

3 Weeks

Creatine kinase M type (CKM) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the N-terminus of Human Creatine Kinase M.
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA346079

USD 539.00

5 Days

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the N terminal of human CKM. Synthetic peptide located within the following region: VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA346080

USD 539.00

5 Days

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the middle region of human CKM. Synthetic peptide located within the following region: GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI