Antibodies

Jump to Filters
View as table Download
GAA Rabbit Polyclonal Antibody
TA334653

USD 539.00

5 Days

Rabbit Polyclonal Anti-GAA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL
GAA (N-term) Rabbit Polyclonal Antibody
AP51752PU-N

USD 580.00

2 Weeks

GAA (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen conjugated synthetic peptide between 173-203 amino acids from the N-terminal region of Human Alpha-glucosidase
GAA Rabbit Polyclonal Antibody
TA356385

USD 539.00

5 Days

GAA Antibody - N-terminal region (ARP44227_P050)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GAA