Antibodies

Jump to Filters
View as table Download
Eph receptor A5 (EPHA5) Rabbit Polyclonal Antibody
TA313828

USD 380.00

In Stock

Rabbit polyclonal anti-EPHA5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHA5.
Eph receptor A5 (EPHA5) Rabbit Polyclonal Antibody
TA344332

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-EPHA5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHA5 antibody: synthetic peptide directed towards the middle region of human EPHA5. Synthetic peptide located within the following region: SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP
Eph receptor A5 (EPHA5) Rabbit Polyclonal Antibody
TA347926

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-EPHA5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHA5 Antibody: A synthesized peptide derived from human EPHA5