Antibodies

Jump to Filters
View as table Download
TIMM50 Rabbit Polyclonal Antibody
TA334156

USD 539.00

5 Days

Rabbit Polyclonal Anti-TIMM50 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TIMM50 Antibody is: synthetic peptide directed towards the C-terminal region of Human TIMM50. Synthetic peptide located within the following region: EDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP
TIMM50 Rabbit Polyclonal Antibody
TA382539

USD 365.00

3 Weeks

TIMM50 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 190-456 of human TIMM50 (NP_001001563.1).
Modifications Unmodified