Antibodies

Jump to Filters
View as table Download
PHGDH Rabbit Polyclonal Antibody
TA351523

USD 380.00

In Stock

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHGDH
PHGDH Rabbit Polyclonal Antibody
TA334410

USD 539.00

5 Days

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF
PHGDH Rabbit Polyclonal Antibody
TA334411

USD 539.00

5 Days

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: SLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPA