Antibodies

Jump to Filters
View as table Download
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA324009

USD 380.00

In Stock

Anti-ACIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1065-1080 amino acids of human apoptotic chromatin condensation inducer 1
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA324010

USD 380.00

In Stock

Anti-ACIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1065-1080 amino acids of human apoptotic chromatin condensation inducer 1
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA344399

USD 539.00

5 Days

Rabbit Polyclonal Anti-Acin1 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Acin1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Acin1. Synthetic peptide located within the following region: RSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAK