Antibodies

Jump to Filters
View as table Download
PECI (ECI2) Rabbit Polyclonal Antibody
TA312299

USD 380.00

4 Weeks

Rabbit polyclonal anti-PECI antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PECI.
PECI (ECI2) Rabbit Polyclonal Antibody
TA346747

USD 539.00

5 Days

Rabbit Polyclonal Anti-PECI Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PECI antibody: synthetic peptide directed towards the middle region of human PECI. Synthetic peptide located within the following region: AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK