Antibodies

Jump to Filters
View as table Download
Adenylosuccinate Lyase (ADSL) Rabbit Polyclonal Antibody
TA323761

USD 380.00

In Stock

Anti-ADSL Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human adenylosuccinate lyase
Adenylosuccinate Lyase (ADSL) Rabbit Polyclonal Antibody
TA342801

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADSL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADSL antibody: synthetic peptide directed towards the middle region of human ADSL. Synthetic peptide located within the following region: RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI