Anti-STEAP4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 441-456 amino acids of human STEAP family member 4 |
Anti-STEAP4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 441-456 amino acids of human STEAP family member 4 |
Anti-STEAP4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 441-456 amino acids of human STEAP family member 4 |
STEAP4 rabbit polyclonal antibody
Applications | ELISA, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | STEAP4 antibody was raised against synthetic peptide - KLH conjugated |
Rabbit polyclonal STEAP4 antibody [#C11207]
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human STEAP4. |
STEAP4 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | STEAP4 antibody was raised against synthetic peptide from human STEAP4. |
Rabbit Polyclonal STEAP4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | STEAP4 antibody was raised against a 14 amino acid peptide from near the center of human STEAP4. |
Rabbit Polyclonal Anti-STEAP4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STEAP4 antibody: synthetic peptide directed towards the C terminal of human STEAP4. Synthetic peptide located within the following region: AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA |