Antibodies

Jump to Filters
View as table Download
GRPR Rabbit Polyclonal Antibody
TA316872

USD 515.00

2 Weeks

GRPR Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Dog, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%).
NPY1R Rabbit Polyclonal Antibody
TA321232

USD 380.00

4 Weeks

Anti-NPY1R rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1
Dopamine Receptor D4 (DRD4) Rabbit Polyclonal Antibody
TA321201

USD 380.00

2 Weeks

Anti-DRD4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human Dopamine receptor D4
GABA A Receptor alpha 5 (GABRA5) Rabbit Polyclonal Antibody
TA338505

USD 539.00

5 Days

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW
EDG1 (S1PR1) Rabbit Polyclonal Antibody
TA306649

USD 570.00

2 Weeks

Rabbit Polyclonal S1P1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1.
Melatonin Receptor 1A (MTNR1A) Rabbit Polyclonal Antibody
TA321735

USD 380.00

4 Weeks

Anti-MTNR1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 130-144 amino acids of human melatonin receptor 1A
GLP2R Rabbit Polyclonal Antibody
TA321635

USD 380.00

2 Weeks

Anti-GLP2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-179 amino acids of human glucagon-like peptide 2 receptor
beta 2 Adrenergic Receptor (ADRB2) Rabbit Polyclonal Antibody
TA323758

USD 380.00

2 Weeks

Anti-ADRB2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 2, surface
BDKRB1 Rabbit Polyclonal Antibody
TA317579

USD 515.00

In Stock

B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%).
CRLR (CALCRL) Rabbit Polyclonal Antibody
TA351107

USD 380.00

In Stock

Rabbit Polyclonal Anti-CALCRL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CALCRL
alpha 1a Adrenergic Receptor (ADRA1A) Rabbit Polyclonal Antibody
TA308493

USD 625.00

5 Days

Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)

Applications IF, IHC, WB
Reactivities Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348)
Orexin Receptor 1 (HCRTR1) Rabbit Polyclonal Antibody
TA321362

USD 380.00

2 Weeks

Anti-HCRTR1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 393-405 amino acids of Human hypocretin (orexin) receptor 1
Somatostatin Receptor 3 (SSTR3) Rabbit Polyclonal Antibody
TA323276

USD 380.00

In Stock

Anti-SSTR3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 405-418 amino acids of human somatostatin receptor 3
Dopamine D2 Receptor (DRD2) Rabbit Polyclonal Antibody
TA316680

USD 515.00

5 Days

Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human (Predicted: Monkey, Rabbit)
Conjugation Unconjugated
Immunogen DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%).
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA321416

USD 380.00

4 Weeks

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor