Antibodies

Jump to Filters
View as table Download
SMNDC1 (N-term) Rabbit Polyclonal Antibody
AP53946PU-N

USD 580.00

2 Weeks

SMNDC1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 19~48 amino acids from the N-terminal region of human SMNDC1
SMNDC1 Rabbit Polyclonal Antibody
TA345934

USD 539.00

5 Days

Rabbit Polyclonal Anti-SMNDC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMNDC1 antibody: synthetic peptide directed towards the middle region of human SMNDC1. Synthetic peptide located within the following region: QFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSK
SMNDC1 Rabbit Polyclonal Antibody
TA345933

USD 539.00

5 Days

Rabbit Polyclonal Anti-SMNDC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMNDC1 antibody: synthetic peptide directed towards the C terminal of human SMNDC1. Synthetic peptide located within the following region: KGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ