Antibodies

Jump to Filters
View as table Download
Kir6.2 (KCNJ11) Rabbit Polyclonal Antibody
TA349931

USD 380.00

In Stock

Rabbit Polyclonal Anti-KCNJ11 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNJ11
Kir6.2 (KCNJ11) Rabbit Polyclonal Antibody
TA332897

USD 365.00

3 Weeks

Rabbit anti-KCNJ11 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human KCNJ11
Kir6.2 (KCNJ11) Rabbit Polyclonal Antibody
TA338550

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCNJ11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KCNJ11 antibody is: synthetic peptide directed towards the middle region of HUMAN KCNJ11. Synthetic peptide located within the following region: SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLII