Antibodies

Jump to Filters
View as table Download
PPAR delta (PPARD) (C-term) Rabbit Polyclonal Antibody
AP53408PU-N

USD 580.00

2 Weeks

PPAR delta (PPARD) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 374-402 amino acids from the C-terminal region of human PPAR-delta
PPAR delta (PPARD) Rabbit Polyclonal Antibody
TA343593

USD 539.00

5 Days

Rabbit Polyclonal Anti-PPARD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARD antibody: synthetic peptide directed towards the n terminal of human PPARD. Synthetic peptide located within the following region: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSS
PPAR delta (PPARD) Rabbit Polyclonal Antibody
TA343594

USD 485.00

5 Days

Rabbit Polyclonal Anti-PPARD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARD antibody: synthetic peptide directed towards the C terminal of human PPARD. Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
PPAR delta (PPARD) Rabbit Polyclonal Antibody
TA332820

USD 365.00

3 Weeks

Rabbit anti-PPARD Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPARD
PPAR delta (PPARD) Rabbit Polyclonal Antibody
TA324526

USD 580.00

5 Days

Rabbit polyclonal PPARD Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PPARD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human PPARD.
PPAR delta (PPARD) Rabbit Polyclonal Antibody
TA332042

USD 485.00

5 Days

Rabbit Polyclonal Anti-PPARD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPARD Antibody: synthetic peptide directed towards the middle region of human PPARD. Synthetic peptide located within the following region: NPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIET
PPAR delta (PPARD) Rabbit Polyclonal Antibody
TA354466

USD 365.00

5 Days

Rabbit anti PPARb Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The full-length recombinant protein of human PPAR-beta.
PPAR delta (PPARD) Rabbit Polyclonal Antibody
TA354469

USD 365.00

5 Days

Rabbit anti PPARd Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated