Antibodies

Jump to Filters
View as table Download
Apolipoprotein A II (APOA2) Rabbit Polyclonal Antibody
TA335017

USD 539.00

5 Days

Rabbit Polyclonal Anti-APOA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME
Apolipoprotein A II (APOA2) Rabbit Polyclonal Antibody
TA328111

USD 580.00

5 Days

Rabbit polyclonal anti-APOA2 antibody (Center)

Applications WB
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen This APOA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-56 amino acids from the Central region of human APOA2.