Antibodies

Jump to Filters
View as table Download
ACADM Rabbit Polyclonal Antibody
AP17073PU-N

USD 580.00

2 Weeks

ACADM rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 196~225 amino acids from the Center region of Human ACADM.
ACADM Rabbit Polyclonal Antibody
TA331168

USD 485.00

5 Days

Rabbit Polyclonal Anti-ACADM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG
ACADM Rabbit Polyclonal Antibody
TA332452

USD 365.00

3 Weeks

Rabbit anti-ACADM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACADM
ACADM Rabbit Polyclonal Antibody
TA331167

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACADM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT