Antibodies

Jump to Filters
View as table Download
Alcohol Dehydrogenase (ADH1A) Rabbit Polyclonal Antibody
TA323597

USD 380.00

4 Weeks

Anti-ADH1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human alcohol dehydrogenase 1A (class I), alpha polypeptide
Alcohol Dehydrogenase (ADH1A) Rabbit Polyclonal Antibody
TA323596

USD 380.00

In Stock

Anti-ADH1A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human alcohol dehydrogenase 1A (class I), alpha polypeptide
Alcohol Dehydrogenase (ADH1A) Rabbit Polyclonal Antibody
TA346210

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADH1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH1A antibody: synthetic peptide directed towards the N terminal of human ADH1A. Synthetic peptide located within the following region: ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA
Alcohol Dehydrogenase (ADH1A) Rabbit Polyclonal Antibody
TA346211

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADH1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH1A antibody: synthetic peptide directed towards the N terminal of human ADH1A. Synthetic peptide located within the following region: NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA