Antibodies

Jump to Filters
View as table Download
SLC2A2 Rabbit Polyclonal Antibody
TA336933

USD 560.00

2 Weeks

Rabbit Polyclonal Glut2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human GLUT2 protein (between residues 50-150) [UniProt P11168]
SLC2A2 Rabbit Polyclonal Antibody
TA350684

USD 380.00

In Stock

Rabbit Polyclonal Anti-SLC2A2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC2A2
SLC2A2 Rabbit Polyclonal Antibody
TA346176

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC2A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC2A2 antibody: synthetic peptide directed towards the N terminal of human SLC2A2. Synthetic peptide located within the following region: ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST