Rabbit Polyclonal Antibody against YAP
Applications | ChIP, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant YAP protein expressed in bacteria. |
Rabbit Polyclonal Antibody against YAP
Applications | ChIP, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant YAP protein expressed in bacteria. |
Rabbit Polyclonal Anti-YAP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-YAP1 antibody: synthetic peptide directed towards the C terminal of human YAP1. Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS |
Rabbit polyclonal anti-YAP antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human YAP. |
Rabbit Polyclonal YAP Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human YAP |
Rabbit Polyclonal YAP (Ser127) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human YAP around the phosphorylation site of Serine 127 |
Modifications | Phospho-specific |