Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-FABP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the N terminal of human FABP3. Synthetic peptide located within the following region: NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL |
Rabbit Polyclonal Anti-FABP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV |
Rabbit Polyclonal Anti-FABP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG |
FABP3 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human FABP3 (NP_004093.1). |
| Modifications | Unmodified |
FABP3 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human FABP3 |
FABP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse FABP3 |
Active filters
Target Symbol
- FABP3
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal