Antibodies

Jump to Filters
View as table Download
Alpha Dystroglycan (DAG1) Rabbit Polyclonal Antibody
TA375317

USD 365.00

3 Weeks

DAG1 Rabbit polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 654-749 of human DAG1 (NP_004384.4).
Modifications Unmodified
Dag1 Rabbit Polyclonal Antibody
TA339412

USD 539.00

5 Days

Rabbit Polyclonal Anti-Dag1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dag1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM