Antibodies

Jump to Filters
View as table Download
C1GALT1C1 Rabbit Polyclonal Antibody
TA369868

USD 380.00

4 Weeks

C1GALT1C1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human C1GALT1C1
C1GALT1C1 Rabbit Polyclonal Antibody
TA335381

USD 539.00

5 Days

Rabbit Polyclonal Anti-C1galt1c1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-C1galt1c1 Antibody is: synthetic peptide directed towards the N-terminal region of Rat C1galt1c1. Synthetic peptide located within the following region: SFQVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDT
C1GALT1C1 Rabbit Polyclonal Antibody
TA360425

USD 539.00

5 Days

C1GALT1C1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human C1GALT1C1
C1GALT1C1 Rabbit Polyclonal Antibody
TA374133

USD 365.00

3 Weeks

C1GALT1C1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-190 of human C1GALT1C1 (NP_689905.1).
Modifications Unmodified