Antibodies

View as table Download

HAO1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-370 of human HAO1 (NP_060015.1).
Modifications Unmodified

HAO1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human HAO1

Rabbit Polyclonal Anti-HAO1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAO1 antibody: synthetic peptide directed towards the C terminal of human HAO1. Synthetic peptide located within the following region: GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV