Antibodies

Jump to Filters
View as table Download
NCOR2 Rabbit Polyclonal Antibody
TA314945

USD 380.00

4 Weeks

Rabbit polyclonal anti-NCOR2 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NCOR2.
NCOR2 Rabbit Polyclonal Antibody
TA330553

USD 485.00

5 Days

Rabbit Polyclonal Anti-NCOR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCOR2 antibody: synthetic peptide directed towards the N terminal of human NCOR2. Synthetic peptide located within the following region: DKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEA
NCOR2 Rabbit Polyclonal Antibody
TA330552

USD 539.00

5 Days

Rabbit Polyclonal Anti-NCOR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCOR2 antibody: synthetic peptide directed towards the N terminal of human NCOR2. Synthetic peptide located within the following region: PMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDE