Antibodies

Jump to Filters
View as table Download
CARD12 (NLRC4) Rabbit Polyclonal Antibody
TA306119

USD 570.00

5 Days

Rabbit Polyclonal Ipaf Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Ipaf antibody was raised against a synthetic peptide corresponding to amino acids near the C-terminus of human Ipaf.
CARD12 (NLRC4) Rabbit Polyclonal Antibody
TA336852

USD 550.00

5 Days

Rabbit Polyclonal CARD12 Antibody

Applications FC, ICC/IF, IHC, Immunoblotting
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human CARD12 protein (between residues 600-700) [UniProt Q9NPP4]
CARD12 (NLRC4) Rabbit Polyclonal Antibody
TA330316

USD 539.00

5 Days

Rabbit Polyclonal Anti-NLRC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRC4 antibody: synthetic peptide directed towards the C terminal of human NLRC4. Synthetic peptide located within the following region: QLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQV
CARD12 (NLRC4) Rabbit Polyclonal Antibody
TA336853

USD 550.00

5 Days

Rabbit Polyclonal CARD12 Antibody

Applications ICC/IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human CARD12 protein (between residues 950-1015) [UniProt Q9NPP4]