Antibodies

View as table Download

Rabbit Polyclonal Anti-DNALI1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DNALI1 Antibody: synthetic peptide directed towards the N terminal of human DNALI1. Synthetic peptide located within the following region: MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA

DNALI1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen conjugated synthetic peptide between 214-243 amino acids from the C-terminal region of Human DNALI1.

Rabbit Polyclonal Anti-DNALI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DNALI1 Antibody: synthetic peptide directed towards the C terminal of human DNALI1. Synthetic peptide located within the following region: ALQAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVE