Antibodies

Jump to Filters
View as table Download
TLK1 Rabbit Polyclonal Antibody
TA312355

USD 380.00

In Stock

Rabbit polyclonal anti-TLK1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TLK1.
TLK1 Rabbit Polyclonal Antibody
TA382561

USD 365.00

3 Weeks

TLK1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 160-230 of human TLK1 (NP_036422.3).
Modifications Unmodified
TLK1 Rabbit Polyclonal Antibody
TA319197

USD 765.00

5 Days

Rabbit polyclonal anti-Tlk1 antibody

Applications WB
Reactivities Human, Chimpanzee, Dog, Orang-Utan
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 737-751 of human Tlk1 (Tousled-like kinase) (isoform 1) protein.
TLK1 Rabbit Polyclonal Antibody
TA344373

USD 539.00

5 Days

Rabbit Polyclonal Anti-TLK1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLK1 antibody: synthetic peptide directed towards the middle region of human TLK1. Synthetic peptide located within the following region: RQIDEQQKLLEKYKERLNKCISMSKKLLIEKSTQEKLSSREKSMQDRLRL
TLK1 Rabbit Polyclonal Antibody
TA344374

USD 539.00

5 Days

Rabbit Polyclonal Anti-TLK1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLK1 antibody: synthetic peptide directed towards the N terminal of human TLK1. Synthetic peptide located within the following region: ESETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNG