Antibodies

View as table Download

Rabbit Polyclonal LGP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LGP2 antibody was raised against a 11 amino acid peptide from near the center of human LGP2.

Rabbit Polyclonal LGP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LGP2 antibody was raised against a 12 amino acid peptide from near the carboxy terminus of human LGP2.

Rabbit Polyclonal LGP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LGP2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human LGP2.

Rabbit Polyclonal Anti-DHX58 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHX58 antibody: synthetic peptide directed towards the N terminal of human DHX58. Synthetic peptide located within the following region: AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM