Rabbit polyclonal PTTG2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PTTG2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 56-84 amino acids from the Central region of human PTTG2. |
Rabbit Polyclonal Anti-PTTG2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTTG2 antibody: synthetic peptide directed towards the middle region of human PTTG2. Synthetic peptide located within the following region: DAPSALPKATRKALGTVNRATEKSVKTNGPRKQKQPSFSAKKMTEKTVKT |
Germany
Japan
United Kingdom
China
