Rabbit Polyclonal Anti-SREBF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the N terminal of human SREBF1. Synthetic peptide located within the following region: AGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGS |
Rabbit Polyclonal Anti-SREBF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the middle region of human SREBF1. Synthetic peptide located within the following region: DAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSR |
Rabbit Polyclonal SREBP-1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SREBP-1 |
Rabbit Polyclonal SREBP-1 (Ser439) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SREBP-1 around the phosphorylation site of Serine 439 |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
